General Information

  • ID:  hor004143
  • Uniprot ID:  NA
  • Protein name:  urotensin I
  • Gene name:  NA
  • Organism:  Hippoglossoides elassodon
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  NA
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  SEEPPMSDLTFHMLRNMHRAKMEGEREQALNRNLLDEV
  • Length:  38
  • Propeptide:  NA
  • Signal peptide:  NA
  • Modification:  T38 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Have the vasodilatation and ACTH-releasing effects
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: vasodilatation:5.3*10(-9)M
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004143_AF2.pdbhor004143_ESM.pdb

Physical Information

Mass: 518625 Formula: C189H307N59O62S4
Absent amino acids: CIWY Common amino acids: E
pI: 4.9 Basic residues: 7
Polar residues: 7 Hydrophobic residues: 9
Hydrophobicity: -102.63 Boman Index: -12210
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 64.21
Instability Index: 8464.74 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19215432
  • Title:  Isolation, Amino-Acid Sequence, Synthesis and Biological Properties of Urotensin I From Hippoglossoides Elassodon